| Bioactivity | [Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA is potentially useful in the study of the pathogenesis of diabetes[1]. | ||||||
| Target | glucagon receptor | ||||||
| Name | [Des-His1,Glu9]-Glucagon amide TFA | ||||||
| Sequence | Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2 | ||||||
| Shortening | SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 | ||||||
| Formula | C150H222F3N41O49S | ||||||
| Molar Mass | 3472.67 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Unson CG, et, al. Biological activities of des-His1[Glu9]glucagon amide, a glucagon antagonist. Peptides. 1989 Nov; 10(6): 1171-7. |
[Des-His1,Glu9]-Glucagon amide TFA
CAS: F: C150H222F3N41O49S W: 3472.67
-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. -Glucagon amide TFA
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.